PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G36730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 166aa    MW: 18188.5 Da    PI: 11.1174
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G36730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.79.5e-2656105251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      rie+k  rqv fskRr+g++KKA+EL  LCdaeva+++fs+ gklyeyss
  LPERR01G36730.1  56 RIEDKASRQVRFSKRRAGLFKKAFELALLCDAEVALLVFSPAGKLYEYSS 105
                      8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.59547107IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-3347106IPR002100Transcription factor, MADS-box
CDDcd002651.78E-3248106No hitNo description
SuperFamilySSF554554.06E-2649118IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-274969IPR002100Transcription factor, MADS-box
PfamPF003194.0E-2556103IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-276984IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-2784105IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGGPHPPAHS PPPPFPPNTT PHTRIHRRER ERARGARVAA AAGDWMARRG RVQLRRIEDK  60
ASRQVRFSKR RAGLFKKAFE LALLCDAEVA LLVFSPAGKL YEYSSSRSLQ NNADESDANQ  120
LEKLEKLLTN ALRDTKSKKM LAKQTGEGSG SGANSSGSRG QEEGNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J5e-1849106259Myocyte-specific enhancer factor 2A
3p57_I5e-1849106259Myocyte-specific enhancer factor 2A
3p57_D5e-1849106259Myocyte-specific enhancer factor 2A
3p57_C5e-1849106259Myocyte-specific enhancer factor 2A
3p57_B5e-1849106259Myocyte-specific enhancer factor 2A
3p57_A5e-1849106259Myocyte-specific enhancer factor 2A
3kov_J5e-1849106259Myocyte-specific enhancer factor 2A
3kov_I5e-1849106259Myocyte-specific enhancer factor 2A
3kov_B5e-1849106259Myocyte-specific enhancer factor 2A
3kov_A5e-1849106259Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0129186e-77AP012918.1 Oryza sativa Indica Group DNA, chromosome 1, BAC clone: K0158A04, cultivar: Kasalath, complete sequence.
GenBankCP0126096e-77CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971093.13e-52PREDICTED: truncated transcription factor CAULIFLOWER D-like
TrEMBLA0A0D9V9N91e-119A0A0D9V9N9_9ORYZ; Uncharacterized protein
STRINGORGLA01G0361900.12e-66(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.14e-24AGAMOUS-like 14